PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014597P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 322aa    MW: 35772.8 Da    PI: 6.5987
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014597P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.4e-142067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l  +    G g+W+ +ar  g+ R++k+c++rw +yl
   MELO3C014597P1 20 KGLWSPEEDDKLMSYMLNNGQGCWSDVARNAGLQRCGKSCRLRWINYL 67
                     678*******************************************97 PP

2Myb_DNA-binding50.25.8e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+ l+++++ +lG++ W+ Ia++++ gRt++++k++w++
   MELO3C014597P1  73 RGAFSPQEEHLIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.7661567IPR017930Myb domain
SuperFamilySSF466891.72E-2718114IPR009057Homeodomain-like
SMARTSM007172.4E-91969IPR001005SANT/Myb domain
PfamPF002494.4E-132067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-222174IPR009057Homeodomain-like
CDDcd001675.81E-82367No hitNo description
PROSITE profilePS5129425.23768122IPR017930Myb domain
SMARTSM007173.0E-1472120IPR001005SANT/Myb domain
PfamPF002494.4E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2575123IPR009057Homeodomain-like
CDDcd001674.93E-1075115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MRKPETTGAS SGTTITKLRK GLWSPEEDDK LMSYMLNNGQ GCWSDVARNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EHLIIHLHSL LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKNLSSTPS PNTSSTGSPS TDSKPNLFGG LLSTQDQQQQ SQGLMDEFPI YASDPIIGLD  180
PFPFISAHSG PFFSTTTSTF TGVEPSFFHE DHESFFSNLP LLQSVNNTTT VTATTVVERS  240
LKNETIVKEA NHSNYLINNI NCLANHNNFS NNNNPKTDNN INGGGVGANN FLHEEFSIGE  300
WDLDDLMKDV PSFPCLNFQV Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27151222108B-MYB
1h8a_C8e-271812225128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818420.0LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449719.10.0PREDICTED: transcription factor MYB46
TrEMBLV7AGN08e-97V7AGN0_PHAVU; Uncharacterized protein
STRINGGLYMA11G14200.21e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.17e-67myb domain protein 46